B7-H3 Stable Cell Line

Produktübersicht

• Artikelname: B7-H3 Stable Cell Line
• Artikelnummer: ABI-14-521ACL
• Hersteller Artikelnummer: 14-521ACL
• Alternativnummer: ABI-14-521ACL-1VIAL
• Hersteller: Abeomics
• Kategorie: Zellen/Zellkultur
• Applikation: FA

Produktbeschreibung

B7-H3 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human B7-H3 (also known as CD276). Sequence data: hB7-H3 (accession number NP_001019907) MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGT DATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQD

Anwendungsbeschreibung

• Application Verdünnung: Application:. Screen for antibodies of human B7-H3 through Flow Cytometry. Culture conditions: Cells should be grown at 37C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and