CD28 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human CD28 (Cluster of Differentiation 28). Sequence data: hCD28 (accession number NP_006130) MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSC KYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYS
Application Verdünnung:
Application:. Screen for antibodies of human CD28 through Flow Cytometry. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
