GFP/U87MG Stable Cell Line

Artikelnummer: ABI-14-903ACL
Artikelname: GFP/U87MG Stable Cell Line
Artikelnummer: ABI-14-903ACL
Hersteller Artikelnummer: 14-903ACL
Alternativnummer: ABI-14-903ACL-1VIAL
Hersteller: Abeomics
Kategorie: Zellen/Zellkultur
Applikation: FA, FACS
GFP/U87MG Stable Cell Line is a stably transfected U-87 MG cell line which expresses enhanced green fluorescent protein (eGFP). Sequence data: Amino acid sequence of eGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQH
Application Verdünnung: Application:. Screen for GFP through Flow Cytometry. Screen for GFP through Fluorescence Microscopy. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10