GFP-Ba/F3 Stable Cell Line is a stably transfected Jurkat cell line which expresses enhanced green fluorescent protein (eGFP). Sequence data: Amino acid sequence of eGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHD
Application Verdünnung:
Application:. Screen for GFP through Flow Cytometry. Screen for GFP through Fluorescence Microscopy. Culture conditions: Cells should be grown at 37oC with 5% CO2 using RPMI medium supplemented with 10% heat-inactivated FBS, 1 mM sodium pyruvate, 10 mM H
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
