GFP/RAW264.7 Stable Cell Line is a stably transfected Jurkat cell line which expresses enhanced green fluorescent protein (eGFP). Sequence data: Amino acid sequence of eGFP MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMK
Application Verdünnung:
Application:. Screen for GFP through Flow Cytometry. Screen for GFP through Fluorescence Microscopy. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ 2 mM L-Glutamine, 4.5g/L Glucose and 1 mM Sodium Pyruvate) supplement
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten