ALAS1 (Human) Recombinant Protein (Q01)

Artikelnummer: ABN-H00000211-Q01
Artikelname: ALAS1 (Human) Recombinant Protein (Q01)
Artikelnummer: ABN-H00000211-Q01
Hersteller Artikelnummer: H00000211-Q01
Alternativnummer: ABN-H00000211-Q01-10,ABN-H00000211-Q01-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human ALAS1 partial ORF ( NP_000679, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 211
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Target-Kategorie: ALAS1