BCAT2 (Human) Recombinant Protein (P01)

Artikelnummer: ABN-H00000587-P01
Artikelname: BCAT2 (Human) Recombinant Protein (P01)
Artikelnummer: ABN-H00000587-P01
Hersteller Artikelnummer: H00000587-P01
Alternativnummer: ABN-H00000587-P01-10,ABN-H00000587-P01-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human BCAT2 full-length ORF ( NP_001181.2, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 587
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLW
Target-Kategorie: BCAT2