BMP2 (Human) Recombinant Protein (Q03)

Artikelnummer: ABN-H00000650-Q03
Artikelname: BMP2 (Human) Recombinant Protein (Q03)
Artikelnummer: ABN-H00000650-Q03
Hersteller Artikelnummer: H00000650-Q03
Alternativnummer: ABN-H00000650-Q03-10,ABN-H00000650-Q03-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human BMP2 partial ORF (NP_001191, 231 a.a. - 330 a.a.) recombinant protein with GST tag at N-terminal.
Tag: GST
UniProt: 650
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP
Target-Kategorie: BMP2