CD28 (Human) Recombinant Protein
Artikelnummer:
ABN-H00000940-G01
Artikelname: |
CD28 (Human) Recombinant Protein |
Artikelnummer: |
ABN-H00000940-G01 |
Hersteller Artikelnummer: |
H00000940-G01 |
Alternativnummer: |
ABN-H00000940-G01-10 |
Hersteller: |
Abnova |
Kategorie: |
Proteine/Peptide |
Applikation: |
AP |
Spezies Reaktivität: |
Human |
Human CD28 full-length ORF (AAH93698.1) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
Tag: |
None |
UniProt: |
940 |
Puffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Formulierung: |
Liquid |
Sequenz: |
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
Target-Kategorie: |
CD28 |
Application Verdünnung: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |