IL15 (Human) Recombinant Protein (P02)

Artikelnummer: ABN-H00003600-P02
Artikelname: IL15 (Human) Recombinant Protein (P02)
Artikelnummer: ABN-H00003600-P02
Hersteller Artikelnummer: H00003600-P02
Alternativnummer: ABN-H00003600-P02-10,ABN-H00003600-P02-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human IL15 full-length ORF ( NP_000576.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 3600
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Target-Kategorie: IL15