MYH9 (Human) Recombinant Protein (Q02)

Artikelnummer: ABN-H00004627-Q02
Artikelname: MYH9 (Human) Recombinant Protein (Q02)
Artikelnummer: ABN-H00004627-Q02
Hersteller Artikelnummer: H00004627-Q02
Alternativnummer: ABN-H00004627-Q02-10,ABN-H00004627-Q02-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human MYH9 partial ORF ( NP_002464.1, 1747 a.a. - 1852 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 4627
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: LINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVD
Target-Kategorie: MYH9