P2RY2 (Human) Recombinant Protein

Artikelnummer: ABN-H00005029-G01
Artikelname: P2RY2 (Human) Recombinant Protein
Artikelnummer: ABN-H00005029-G01
Hersteller Artikelnummer: H00005029-G01
Alternativnummer: ABN-H00005029-G01-2
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP
Spezies Reaktivität: Human
Human P2RY2 full-length ORF (AAH12104.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 5029
Puffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Formulierung: Liquid
Sequenz: MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVLGLCLNAVALYIFLCRLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAVVLAVF
Target-Kategorie: P2RY2
Application Verdünnung: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.