SERPINB9 (Human) Recombinant Protein (Q01)

Artikelnummer: ABN-H00005272-Q01
Artikelname: SERPINB9 (Human) Recombinant Protein (Q01)
Artikelnummer: ABN-H00005272-Q01
Hersteller Artikelnummer: H00005272-Q01
Alternativnummer: ABN-H00005272-Q01-10,ABN-H00005272-Q01-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human SERPINB9 partial ORF ( NP_004146, 279 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 5272
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
Target-Kategorie: SERPINB9