ST3GAL3 (Human) Recombinant Protein (P01)

Artikelnummer: ABN-H00006487-P01
Artikelname: ST3GAL3 (Human) Recombinant Protein (P01)
Artikelnummer: ABN-H00006487-P01
Hersteller Artikelnummer: H00006487-P01
Alternativnummer: ABN-H00006487-P01-10,ABN-H00006487-P01-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human ST3GAL3 full-length ORF ( NP_777624.1, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 6487
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSSKYSHSSSPQEKPVADSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWL
Target-Kategorie: ST3GAL3