HIST1H2BC (Human) Recombinant Protein (P01)

Artikelnummer: ABN-H00008347-P01
Artikelname: HIST1H2BC (Human) Recombinant Protein (P01)
Artikelnummer: ABN-H00008347-P01
Hersteller Artikelnummer: H00008347-P01
Alternativnummer: ABN-H00008347-P01-10,ABN-H00008347-P01-25
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP, Array, ELISA, WB
Spezies Reaktivität: Human
Human HIST1H2BC full-length ORF ( AAH09612, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
Tag: GST
UniProt: 8347
Puffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequenz: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Target-Kategorie: HIST1H2BC