OR1E1 (Human) Recombinant Protein

Artikelnummer: ABN-H00008387-G01
Artikelname: OR1E1 (Human) Recombinant Protein
Artikelnummer: ABN-H00008387-G01
Hersteller Artikelnummer: H00008387-G01
Alternativnummer: ABN-H00008387-G01-2
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP
Spezies Reaktivität: Human
Human OR1E1 full-length ORF (ENSP00000313384) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 8387
Puffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Formulierung: Liquid
Sequenz: MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFSTCGSHLSVVSLFYGT
Target-Kategorie: OR1E1
Application Verdünnung: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.