TNFRSF10D (Human) Recombinant Protein

Artikelnummer: ABN-H00008793-H03
Artikelname: TNFRSF10D (Human) Recombinant Protein
Artikelnummer: ABN-H00008793-H03
Hersteller Artikelnummer: H00008793-H03
Alternativnummer: ABN-H00008793-H03-25
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: ELISA, SDS-PAGE, WB
Spezies Reaktivität: Human
Purified TNFRSF10D (AAH52270.1 56 a.a. - 187 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Konzentration: 10 ug/ml
Tag: His-Flag-StrepII
UniProt: 8793
Puffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Formulierung: Liquid
Sequenz: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAAS
Target-Kategorie: TNFRSF10D