P2RY5 (Human) Recombinant Protein
Artikelnummer:
ABN-H00010161-G01
Artikelname: |
P2RY5 (Human) Recombinant Protein |
Artikelnummer: |
ABN-H00010161-G01 |
Hersteller Artikelnummer: |
H00010161-G01 |
Alternativnummer: |
ABN-H00010161-G01-2 |
Hersteller: |
Abnova |
Kategorie: |
Proteine/Peptide |
Applikation: |
AP |
Spezies Reaktivität: |
Human |
Human P2RY5 full-length ORF (NP_005758.2) recombinant protein without tag.This product is belong to Proteoliposome (PL). |
Tag: |
None |
UniProt: |
10161 |
Puffer: |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Formulierung: |
Liquid |
Sequenz: |
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSL |
Target-Kategorie: |
P2RY5 |
Application Verdünnung: |
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |