CALCRL (Human) Recombinant Protein

Artikelnummer: ABN-H00010203-G01
Artikelname: CALCRL (Human) Recombinant Protein
Artikelnummer: ABN-H00010203-G01
Hersteller Artikelnummer: H00010203-G01
Alternativnummer: ABN-H00010203-G01-2
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP
Spezies Reaktivität: Human
Human CALCRL full-length ORF (NP_005786.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 10203
Puffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Formulierung: Liquid
Sequenz: MEKKCTLYFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMW
Target-Kategorie: CALCRL
Application Verdünnung: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.