LILRA2 (Human) Recombinant Protein

Artikelnummer: ABN-H00011027-G01
Artikelname: LILRA2 (Human) Recombinant Protein
Artikelnummer: ABN-H00011027-G01
Hersteller Artikelnummer: H00011027-G01
Alternativnummer: ABN-H00011027-G01-10
Hersteller: Abnova
Kategorie: Proteine/Peptide
Applikation: AP
Spezies Reaktivität: Human
Human LILRA2 full-length ORF (NP_006857.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).
Tag: None
UniProt: 11027
Puffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Formulierung: Liquid
Sequenz: MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFV
Target-Kategorie: LILRA2
Application Verdünnung: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.