TGFB1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7005
Artikelname: TGFB1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7005
Hersteller Artikelnummer: P7005
Alternativnummer: ABN-P7005-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human TGFB1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7040
Puffer: Lyophilized from PBS, pH 8.0.
Formulierung: Lyophilized
Sequenz: MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Target-Kategorie: TGFB1
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.