THPO (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7007
Artikelname: THPO (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7007
Hersteller Artikelnummer: P7007
Alternativnummer: ABN-P7007-100
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human THPO recombinant protein with polyhistidine tag at the N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7066
Puffer: Lyophilized from PBS, pH 7.4.
Formulierung: Lyophilized
Sequenz: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL
Target-Kategorie: THPO
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.