IL1B (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7106
Artikelname: IL1B (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7106
Hersteller Artikelnummer: P7106
Alternativnummer: ABN-P7106-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL1B (P01584, 117 a.a.- 269 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 3553
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Target-Kategorie: IL1B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.