CSF3 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7107
Artikelname: CSF3 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7107
Hersteller Artikelnummer: P7107
Alternativnummer: ABN-P7107-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CSF3 (Q8N4W3, 27 a.a. - 200 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 1440
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: TVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRH
Target-Kategorie: CSF3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.