IFNG (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7111
Artikelname: IFNG (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7111
Hersteller Artikelnummer: P7111
Alternativnummer: ABN-P7111-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IFNG (P01579, 24 a.a. - 166 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 3458
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Target-Kategorie: IFNG
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.