IL3 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7113
Artikelname: IL3 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7113
Hersteller Artikelnummer: P7113
Alternativnummer: ABN-P7113-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL3 (Q6GS87, 20 a.a. - 152 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 3562
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Target-Kategorie: IL3
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.