Il5 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P7114
Artikelname: Il5 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P7114
Hersteller Artikelnummer: P7114
Alternativnummer: ABN-P7114-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il5 (P04401, 21 a.a. - 133 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 16191
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Target-Kategorie: Il5
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.