IL12 (p35 & p40) (Human) Recombinant Protein

Artikelnummer: ABN-P7119
Artikelname: IL12 (p35 & p40) (Human) Recombinant Protein
Artikelnummer: ABN-P7119
Hersteller Artikelnummer: P7119
Alternativnummer: ABN-P7119-5
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL12 p35 (P29459, 23 a.a.- 219 a.a.) and IL12 p40 (P29460, 23 a.a.- 328 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 3592, 3593
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS, IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTI
Target-Kategorie: IL12A
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.