Il11 (Mouse) Recombinant Protein, Human

Artikelnummer: ABN-P7121
Artikelname: Il11 (Mouse) Recombinant Protein, Human
Artikelnummer: ABN-P7121
Hersteller Artikelnummer: P7121
Alternativnummer: ABN-P7121-10
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il11 (P47873, 23 a.a. - 199 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 16156
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Target-Kategorie: Il11
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.