CNTF (Human) Recombinant Protein

Artikelnummer: ABN-P7122
Artikelname: CNTF (Human) Recombinant Protein
Artikelnummer: ABN-P7122
Hersteller Artikelnummer: P7122
Alternativnummer: ABN-P7122-10
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human CNTF (P26441-1, 1 a.a. - 200 a.a.) full-length recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 1270
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTV RSIHDLRFISSHQTGIPARGSHYIANNKKM
Target-Kategorie: CNTF
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.