VEGFA (Human) Recombinant Protein

Artikelnummer: ABN-P7123
Artikelname: VEGFA (Human) Recombinant Protein
Artikelnummer: ABN-P7123
Hersteller Artikelnummer: P7123
Alternativnummer: ABN-P7123-10
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human VEGFA (P15692-4, 27 a.a. - 191 a.a.) partial recombinant protein expressed in HEK293 cells.
Tag: None
UniProt: 7422
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: CHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Target-Kategorie: VEGFA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.