Abcc8 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7193
Artikelname: Abcc8 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7193
Hersteller Artikelnummer: P7193
Alternativnummer: ABN-P7193-50
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human Abcc8 (P09429, 1 a.a. - 215 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Tag: His
UniProt: 2559
Puffer: Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Formulierung: Lyophilized
Sequenz: MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFILLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYG181MLLLVEVNVIRVRRYVFFKTPREVKPPEDLQDLGV
Target-Kategorie: GABRA6