Il4 (Porcine) Recombinant Protein, Mammal

Artikelnummer: ABN-P7268
Artikelname: Il4 (Porcine) Recombinant Protein, Mammal
Artikelnummer: ABN-P7268
Hersteller Artikelnummer: P7268
Alternativnummer: ABN-P7268-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Porcine
Porcine IL4 (Q04745, 25 a.a. - 133 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 397225
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
Target-Kategorie: IL4
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.