TNFRSF9 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7271
Artikelname: TNFRSF9 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7271
Hersteller Artikelnummer: P7271
Alternativnummer: ABN-P7271-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human TNFRSF9 (Q07011, 18 a.a. - 184 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 3604
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Formulierung: Lyophilized
Sequenz: TRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS
Target-Kategorie: TNFRSF9
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.