TNFRSF10B (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7272
- Bilder (0)
Artikelname: | TNFRSF10B (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7272 |
Hersteller Artikelnummer: | P7272 |
Alternativnummer: | ABN-P7272-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human TNFRSF10B (O14763, 52 a.a. - 183 a.a) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 8795 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
Formulierung: | Lyophilized |
Sequenz: | ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES |
Target-Kategorie: | TNFRSF10B |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |