TNFRSF10B (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7272
Artikelname: TNFRSF10B (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7272
Hersteller Artikelnummer: P7272
Alternativnummer: ABN-P7272-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human TNFRSF10B (O14763, 52 a.a. - 183 a.a) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 8795
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Formulierung: Lyophilized
Sequenz: ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES
Target-Kategorie: TNFRSF10B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.