HBEGF (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7275
Artikelname: HBEGF (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7275
Hersteller Artikelnummer: P7275
Alternativnummer: ABN-P7275-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 1839
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Formulierung: Lyophilized
Sequenz: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAP SCICHPGYHGERCHGLSL
Target-Kategorie: HBEGF
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.