Ccl20 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P7287
Artikelname: Ccl20 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P7287
Hersteller Artikelnummer: P7287
Alternativnummer: ABN-P7287-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Ccl20 (O89093, 28 a.a. - 97 a.a.) partial recombinant protein expressed in Escherichia coli.
Tag: None
UniProt: 20297
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Formulierung: Lyophilized
Sequenz: ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Target-Kategorie: Ccl20
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.