LEP (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7294
- Bilder (0)
Artikelname: | LEP (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7294 |
Hersteller Artikelnummer: | P7294 |
Alternativnummer: | ABN-P7294-5 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human LEP (P41159, 22 a.a. - 167 a.a.) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 3952 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
Formulierung: | Lyophilized |
Sequenz: | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
Target-Kategorie: | LEP |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |