Tnfsf13 (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7297
- Bilder (0)
Artikelname: | Tnfsf13 (Mouse) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7297 |
Hersteller Artikelnummer: | P7297 |
Alternativnummer: | ABN-P7297-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Tnfsf13 (Q9D777, 50 a.a. - 241 a.a.) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 69583 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
Formulierung: | Lyophilized |
Sequenz: | MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL |
Target-Kategorie: | Tnfsf13 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |