Egf (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7299
- Bilder (0)
Artikelname: | Egf (Mouse) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7299 |
Hersteller Artikelnummer: | P7299 |
Alternativnummer: | ABN-P7299-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Egf (P01132, 977 a.a. - 1029 a.a.) partial recombinant protein expressed in Escherichia coli. |
Tag: | None |
UniProt: | 13645 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
Formulierung: | Lyophilized |
Sequenz: | MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
Target-Kategorie: | Egf |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |