EPO (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P7301
Artikelname: EPO (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P7301
Hersteller Artikelnummer: P7301
Alternativnummer: ABN-P7301-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human EPO (P01588, 28 a.a. - 193 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 2056
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Formulierung: Lyophilized
Sequenz: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Target-Kategorie: EPO
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.