EPO (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7301
- Bilder (0)
Artikelname: | EPO (Human) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7301 |
Hersteller Artikelnummer: | P7301 |
Alternativnummer: | ABN-P7301-10 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human EPO (P01588, 28 a.a. - 193 a.a.) partial recombinant protein expressed in CHO cells. |
Tag: | None |
UniProt: | 2056 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
Formulierung: | Lyophilized |
Sequenz: | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Target-Kategorie: | EPO |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |