Csf2 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P7303
Artikelname: Csf2 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P7303
Hersteller Artikelnummer: P7303
Alternativnummer: ABN-P7303-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Csf2 (Q14AD9, 18 a.a. - 141 a.a.) partial recombinant protein expressed in CHO cells.
Tag: None
UniProt: 12981
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Target-Kategorie: Csf2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.