Kitl (Mouse) Recombinant Protein, Yeast

Artikelnummer: ABN-P7310
Artikelname: Kitl (Mouse) Recombinant Protein, Yeast
Artikelnummer: ABN-P7310
Hersteller Artikelnummer: P7310
Alternativnummer: ABN-P7310-10
Hersteller: Abnova
Wirt: Yeast
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Kitl (P20826, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris.
Tag: None
UniProt: 17311
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Target-Kategorie: Kitl
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.