Kitl (Mouse) Recombinant Protein, Yeast
Artikelnummer:
ABN-P7310
- Bilder (0)
Artikelname: | Kitl (Mouse) Recombinant Protein, Yeast |
Artikelnummer: | ABN-P7310 |
Hersteller Artikelnummer: | P7310 |
Alternativnummer: | ABN-P7310-10 |
Hersteller: | Abnova |
Wirt: | Yeast |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Kitl (P20826, 26 a.a. - 189 a.a.) partial recombinant protein expressed in Pichia pastoris. |
Tag: | None |
UniProt: | 17311 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | MTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Target-Kategorie: | Kitl |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |