IFNA2 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7315
Artikelname: IFNA2 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7315
Hersteller Artikelnummer: P7315
Alternativnummer: ABN-P7315-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human IFNA2 (P01563, 24 a.a. - 188 a.a ) K46R mutant partial recombinant protein expressed in Escherichia coli.
UniProt: 3440
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: LSCKSSCSVGCDLPQTHSLGSRKTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFN
Target-Kategorie: IFNA2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.