GH1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7322
Artikelname: GH1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7322
Hersteller Artikelnummer: P7322
Alternativnummer: ABN-P7322-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human GH1 (P01241, 27 a.a. - 217 a.a ) partial recombinant protein expressed in Escherichia coli.
UniProt: 2688
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: AFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Target-Kategorie: GH1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.