PF4 (Human) Recombinant Protein

Artikelnummer: ABN-P7328
Artikelname: PF4 (Human) Recombinant Protein
Artikelnummer: ABN-P7328
Hersteller Artikelnummer: P7328
Alternativnummer: ABN-P7328-10
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human PF4 (P02776, 32 a.a. - 101 a.a ) partial recombinant protein expressed in HEK293 cells.
UniProt: 5196
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Target-Kategorie: PF4
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.