Il17a (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P7330
Artikelname: Il17a (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P7330
Hersteller Artikelnummer: P7330
Alternativnummer: ABN-P7330-10
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Il17a (Q62386, 26 a.a. - 158 a.a.) partial recombinant protein expressed in CHO cell.
UniProt: 16171
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Target-Kategorie: Il17a
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.