Il17a (Mouse) Recombinant Protein, Mammal
Artikelnummer:
ABN-P7330
- Bilder (0)
Artikelname: | Il17a (Mouse) Recombinant Protein, Mammal |
Artikelnummer: | ABN-P7330 |
Hersteller Artikelnummer: | P7330 |
Alternativnummer: | ABN-P7330-10 |
Hersteller: | Abnova |
Wirt: | Mammal |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Il17a (Q62386, 26 a.a. - 158 a.a.) partial recombinant protein expressed in CHO cell. |
UniProt: | 16171 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Target-Kategorie: | Il17a |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |