IL6 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7332
- Bilder (0)
Artikelname: | IL6 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7332 |
Hersteller Artikelnummer: | P7332 |
Alternativnummer: | ABN-P7332-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human IL6 (Q75MH2, 29 a.a. - 212 a.a ) partial recombinant protein expressed in Escherichia coli. |
UniProt: | 3569 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Target-Kategorie: | IL6 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |