NRG1 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P7338
- Bilder (0)
Artikelname: | NRG1 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P7338 |
Hersteller Artikelnummer: | P7338 |
Alternativnummer: | ABN-P7338-10 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Spezies Reaktivität: | Human |
Human NRG1 (Q02297, 177 a.a. - 241 a.a ) partial recombinant protein expressed in Escherichia coli. |
UniProt: | 3084 |
Puffer: | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL. |
Formulierung: | Lyophilized |
Sequenz: | MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK |
Target-Kategorie: | NRG1 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |