NRG1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7338
Artikelname: NRG1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7338
Hersteller Artikelnummer: P7338
Alternativnummer: ABN-P7338-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human NRG1 (Q02297, 177 a.a. - 241 a.a ) partial recombinant protein expressed in Escherichia coli.
UniProt: 3084
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Target-Kategorie: NRG1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.