SHH (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P7339
Artikelname: SHH (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P7339
Hersteller Artikelnummer: P7339
Alternativnummer: ABN-P7339-10
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human SHH (Q15465, 24 a.a. - 197 a.a ) C24II mutant partial recombinant protein expressed in Escherichia coli.
UniProt: 6469
Puffer: Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: IIPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Target-Kategorie: SHH
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.